PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D01G0155
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 232aa    MW: 26487.8 Da    PI: 6.9408
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D01G0155genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding461.2e-141561248
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     g WT+eEd +l  +v+++G  +W+  ++  g+ R++k+c++rw +yl
      Gh_D01G0155 15 GTWTAEEDRKLTAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNYL 61
                     78*****************99************************97 PP

2Myb_DNA-binding58.51.5e-1867111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T+eEde ++ +++ lG++ W++Ia++++ gRt++++k++w++ 
      Gh_D01G0155  67 RGNFTKEEDETIITLHESLGNR-WSAIAAMLP-GRTDNEIKNHWHTN 111
                      89********************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.55961IPR017930Myb domain
SuperFamilySSF466897.03E-3012108IPR009057Homeodomain-like
SMARTSM007174.5E-81363IPR001005SANT/Myb domain
PfamPF002493.6E-121561IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-231568IPR009057Homeodomain-like
CDDcd001674.94E-91661No hitNo description
PROSITE profilePS5129426.36662116IPR017930Myb domain
SMARTSM007178.7E-1866114IPR001005SANT/Myb domain
PfamPF002497.0E-1767111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2669115IPR009057Homeodomain-like
CDDcd001672.48E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MVKKPCCDKS GLRQGTWTAE EDRKLTAYVT RYGCWNWRQL PKFAGLARCG KSCRLRWMNY  60
LRPNLKRGNF TKEEDETIIT LHESLGNRWS AIAAMLPGRT DNEIKNHWHT NLKKHAKHKP  120
STTKLHDKYT NNQNLNDDHL QINPIIPPLI LESSPPPPLS TNTQSSFTTT DNSVESTKAD  180
SVSDFWSEPF LLDILSDDLP TMGASAGFEF DLLDGEILSP FGFYDHLEPF SF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-29121145106B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012451743.11e-175PREDICTED: protein ODORANT1-like
TrEMBLA0A0D2NGT11e-175A0A0D2NGT1_G
STRINGPOPTR_0013s14560.13e-80(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2426334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06180.12e-58myb domain protein 13